Active Recombinant Human IL1RN Protein

• Cat.No.: IL1RN-104H
• Product Overview: Recombinant Human Interleukin-1 Receptor Antagonist Protein is produced by our E.coli expression system and the target gene encoding Arg26-Glu177 is expressed.

Specification

• Description: Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.
• Source: E. coli
• Species: Human
• Form: Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5.
• Bio-activity: Measured by the dose-dependent inhibition of IL-1 stimulation of D10S cells. ED50 is 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg.
• Protein length: Arg26-Glu177
• AA Sequence: MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKM CLSCVKSGDETRLQLEA VNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYF QEDE
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ]
• Official Symbol: IL1RN
• Synonyms: Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1ra3
• Gene ID: 3557
• mRNA Refseq: NM_000577.5
• Protein Refseq: NP_000568.1
• MIM: 147679
• UniProt ID: P18510