Active Recombinant Human IL15 Protein, His-tagged

• Cat.No.: IL15-004H
• Product Overview: Recombinant human IL-15 protein (49-162 aa), fused to His-tag was expressed in E.coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 49-162 a.a.
• Description: Interleukin (IL)-15 is a pleiotropic cytokine that plays a pivotal role in both innate and adaptive immunity. IL-15 is unique among cytokines due to its participation in a trans signaling mechanism in which IL-15 receptor alpha (IL-15R alpha) from one subset of cells presents IL-15 to neighboring IL-2R beta/gamma(c)-expressing cells. This newly discovered cytokine is produced by a wide variety of cells and tissues and like IL-2, stimulates the proliferation of T-lymphocytes and induces the generation of cytotoxic T-lymphocytes (CTLs) and lymphokine-activated killer (LAK) cells.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 1 ng/mL.
• Molecular Mass: 13.9 kDa (123aa) confirmed by MALDI-TOF
• AA Sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH
• Endotoxin: < 1.0 EU per 1μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterin.
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade.
  Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: In Phosphate Buffer Saline(pH7.4) containing 10% glycerol.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens (human) ]
• Official Symbol: IL15
• Synonyms: Interleukin-15; IL-15; interleukin-15
• Gene ID: 3600
• mRNA Refseq: NM_172175
• Protein Refseq: NP_751914
• MIM: 600554
• UniProt ID: P40933