Active Recombinant Human IL15 Protein

• Cat.No.: IL15-100H
• Product Overview: Recombinant Human Interleukin-15 is produced by our E.coli expression system and the target gene encoding Asn49-Ser162 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Asn49-Ser162
• Description: Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
• Bio-activity: Specific Activity is greater than 1.5 x 10^7 IU/mg. Measured by a viral resistance assay using VSV-WISH cells.
• AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILAN NSLSSNGNVTESGCKE CEELEEKNIKEFLQSFVHIVQMFINTS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens (human) ]
• Official Symbol: IL15
• Synonyms: Interleukin-15; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585.5
• Protein Refseq: NP_000576.1
• MIM: 600554
• UniProt ID: P40933