Active Recombinant Human IL15 Protein

• Cat.No.: IL15-134H
• Product Overview: Recombinant Human IL15 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Interleukin 15 (IL-15) is a widely expressed proinflammatory cytokine that is structurally and functionally related to interleukin 2 (IL-2). IL-15 signals through JAK kinases to activate STAT3, STAT5, and STAT6 transcription factors. IL-15 regulates the activation of T cells, neutrophils, and macrophages, and is a stimulatory cytokine promoting dendritic cell function. IL-15 expression is dysregulated in chronic inflammatory disorders, including rheumatoid arthritis, psoriasis, and pulmonary inflammatory diseases. Therefore, IL-15 may serve as an effective therapeutic target, due to the beneficial outcomes of IL-15 neutralization in models of psoriasis and diabetes. Human IL-15 shows activity on mouse cells.
• Bio-activity: CTLL-2 cell proliferation, ≤5 ng/mL
• Molecular Mass: Monomer, 12.9 kDa (115 aa)
• AA Sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens (human) ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585
• Protein Refseq: NP_000576
• MIM: 600554
• UniProt ID: P40933