Active Recombinant Human IL12A/IL12B protein

Cat.No. : IL12A-27H
Product Overview : The hIL-12 consists of two subunits linked via a disulphide bond: P35 (Accession# NP_000873.2: Arg 57- Ser 253) and P40 (Accession# NP_002178.2: Ile 23-Ser 328) was expressed in insect cells as secreted protein (p35, p40).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Non
Protein Length : 57-253;23-328 a.a.
Form : The protein was 0.22μm filtered in 10mM NaH2PO4, 150mM NaCl, pH 7.2.
Bio-activity : ED50 = 0.05 - 0.25 ng/ml, corresponding to a specific activity of 0.4 - 2.0 x 10^7 units/mg, as determined by the production of IFNγ by activated human PBMC in response to IL-12.
Molecular Mass : The total predicted molecular weight is 57 kDa. The non-reduced protein migrates at approximately 55 kDa and the DTT-reduced protein produces two bands migrating at approximately 26 kDa and 40 KDa by SDS-PAGE.
AA Sequence : RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40 Subunit IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWT
Endotoxin : < 1 EU/µg determined by LAL method
Purity : >95 % as determined by SDS-PAGE analysis
Applications : ELISA, WB, Antibody Production, Protein array, Bioassay
Storage : Unopened vial can be stored at -20°C for six months or at -70°C for one year. For maximum results, quick spin vial prior to opening. Stock solutions should be prepared at no less than 10µg/mL in buffer containing carrier protein such as 1% BSA or HSA or 1
Gene Name IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ]
Official Symbol IL12A
Synonyms IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A;
Gene ID 3592
mRNA Refseq NM_000882
Protein Refseq NP_000873
MIM 161560
UniProt ID P29459
Chromosome Location 3p12-q13.2
Pathway African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem;
Function contributes_to cytokine activity; contributes_to cytokine activity; contributes_to growth factor activity; contributes_to growth factor activity; interleukin-12 beta subunit binding; interleukin-12 receptor binding; interleukin-27 binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL12A Products

Required fields are marked with *

My Review for All IL12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon