Active Recombinant Human IL12A/IL12B protein

• Cat.No.: IL12A-27H
• Product Overview: The hIL-12 consists of two subunits linked via a disulphide bond: P35 (Accession# NP_000873.2: Arg 57- Ser 253) and P40 (Accession# NP_002178.2: Ile 23-Ser 328) was expressed in insect cells as secreted protein (p35, p40).

Specification

• Source: Insect cell
• Species: Human
• Form: The protein was 0.22μm filtered in 10mM NaH2PO4, 150mM NaCl, pH 7.2.
• Bio-activity: ED50 = 0.05 - 0.25 ng/ml, corresponding to a specific activity of 0.4 - 2.0 x 10^7 units/mg, as determined by the production of IFNγ by activated human PBMC in response to IL-12.
• Molecular Mass: The total predicted molecular weight is 57 kDa. The non-reduced protein migrates at approximately 55 kDa and the DTT-reduced protein produces two bands migrating at approximately 26 kDa and 40 KDa by SDS-PAGE.
• AA Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40 Subunit IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWT
• Endotoxin: < 1 EU/µg determined by LAL method
• Purity: >95 % as determined by SDS-PAGE analysis
• Applications: ELISA, WB, Antibody Production, Protein array, Bioassay
• Storage: Unopened vial can be stored at -20°C for six months or at -70°C for one year. For maximum results, quick spin vial prior to opening. Stock solutions should be prepared at no less than 10µg/mL in buffer containing carrier protein such as 1% BSA or HSA or 1
• Tag: Non
• Protein length: 57-253;23-328 a.a.

Gene Information

• Gene Name: IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ]
• Official Symbol: IL12A
• Synonyms: IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A
• Gene ID: 3592
• mRNA Refseq: NM_000882
• Protein Refseq: NP_000873
• MIM: 161560
• UniProt ID: P29459
• Chromosome Location: 3p12-q13.2
• Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem
• Function: contributes_to cytokine activity; contributes_to cytokine activity; contributes_to growth factor activity; contributes_to growth factor activity; interleukin-12 beta subunit binding; interleukin-12 receptor binding; interleukin-27 binding; protein binding