Active Recombinant Human IGFBP-1 Protein (26-259aa)
Cat.No. : | IGFBP1-03H |
Product Overview : | Recombinant human IGFBP1 (26-259aa) without tag was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 26-259aa |
Description : | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. |
Form : | Liquid |
Bio-activity : | Measured by its ability to inhibit proliferation using MCF-7 human breast cancer cells in the presence of Human IGF-1. The ED50 range ≤3 μg/mL. |
Molecular Mass : | 25.2 kDa (234aa) |
AA Sequence : | APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | IGFBP1 insulin like growth factor binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | IGFBP1 |
Synonyms | IGFBP1; insulin like growth factor binding protein 1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1; insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; placental protein 12 |
Gene ID | 3484 |
mRNA Refseq | NM_000596 |
Protein Refseq | NP_000587 |
MIM | 146730 |
UniProt ID | P08833 |
◆ Recombinant Proteins | ||
IGFBP1-1065C | Recombinant Canine IGFBP1 Protein, His-tagged | +Inquiry |
Igfbp1-5435M | Recombinant Mouse Igfbp1 protein, His-tagged | +Inquiry |
IGFBP1-4259H | Recombinant Human IGFBP1 Protein (Met1-Asn259), C-His tagged | +Inquiry |
Igfbp1-3082M | Recombinant Mouse Igfbp1 protein, His-tagged | +Inquiry |
Igfbp1-31R | Recombinant Rat Igfbp1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP1-1482CCL | Recombinant Cynomolgus IGFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFBP1 Products
Required fields are marked with *
My Review for All IGFBP1 Products
Required fields are marked with *
0
Inquiry Basket