Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged

• Cat.No.: IFNW1-01H
• Product Overview: Recombinant human IFN-omega (22-195aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 22-195aa
• Description: The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome.
• Form: Liquid
• Bio-activity: Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED50 range ≤0.07 ng/mL.
• Molecular Mass: 20.9 kDa (180aa)
• AA Sequence: LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS< HHHHHH>
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IFNW1 interferon, omega 1 [ Homo sapiens (human) ]
• Official Symbol: IFNW1
• Synonyms: IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1
• Gene ID: 3467
• mRNA Refseq: NM_002177
• Protein Refseq: NP_002168
• MIM: 147553
• UniProt ID: P05000