Active Recombinant Human FGFR3, Fc-tagged, Biotinylated
Cat.No. : | FGFR3-610H |
Product Overview : | The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 - Gly375 region of FGFR3 (Uniprot accession #P22607 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-375 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) |
Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.05 - 0.3 μg/ml |
Molecular Mass : | Calculated molecular mass (kDa): 63.7; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
AA Sequence : | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQV LNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAAN TVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLD VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTD KELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ] |
Official Symbol | FGFR3 |
Synonyms | FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX; |
Gene ID | 2261 |
mRNA Refseq | NM_000142 |
Protein Refseq | NP_000133 |
MIM | 134934 |
UniProt ID | P22607 |
Chromosome Location | 4p16.3 |
Pathway | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGFR ligand binding and activation, organism-specific biosystem; |
Function | ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; nucleotide binding; protein binding; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; |
◆ Recombinant Proteins | ||
FGFR3-610H | Active Recombinant Human FGFR3, Fc-tagged, Biotinylated | +Inquiry |
FGFR3-780HF | Recombinant Human FGFR3 Protein, His-tagged, FITC conjugated | +Inquiry |
FGFR3-204CAF647 | Recombinant Monkey FGFR3 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
FGFR3-207H | Recombinant Human FGFR3 Protein, hIgG-His-tagged | +Inquiry |
FGFR3-1224CF | Recombinant Cynomolgus FGFR3 Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
FGFR3-2596MCL | Recombinant Mouse FGFR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGFR3 Products
Required fields are marked with *
My Review for All FGFR3 Products
Required fields are marked with *
0
Inquiry Basket