Active Recombinant Human FGF2 Protein

• Cat.No.: FGF2-81H
• Product Overview: Recombinant Human FGF2 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. FGF-basic is a critical component for embryonic stem cell culture systems and is necessary for maintaining cells in an undifferentiated state. Degredation of the full length FGF-basic N-terminus results in a truncated FGF-basic 147aa protein, when the protein is isolated from biological sources. The N-terminus extensions influence the localization of FGF-basic within the cell, but do not affect the biological activity of FGF-basic. Therefore, there are no detectable differences in biological activity between the full length FGF-basic 154aa and the truncated FGF-basic 147aa recombinant proteins.
• Bio-activity: 3T3 cell proliferation, ≤5 ng/mL; ≥2.0 x 10^5 units/mg
• Molecular Mass: Monomer, 16.5 kDa (147 aa)
• AA Sequence: MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mm sodium phosphate, 75 mM sodium chloride, pH 7.5
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ]
• Official Symbol: FGF2
• Synonyms: FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2
• Gene ID: 2247
• mRNA Refseq: NM_002006
• Protein Refseq: NP_001997
• MIM: 134920
• UniProt ID: P09038