Active Recombinant Human FGF2 Protein
Cat.No. : | FGF2-81H |
Product Overview : | Recombinant Human FGF2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Basic fibroblast growth factor (FGF-basic), also known as FGF-2, is expressed by endothelial cells and is a mediator of angiogenesis. FGF-basic also has cardioprotective functions during heart injury. FGF-basic is a critical component for embryonic stem cell culture systems and is necessary for maintaining cells in an undifferentiated state. Degredation of the full length FGF-basic N-terminus results in a truncated FGF-basic 147aa protein, when the protein is isolated from biological sources. The N-terminus extensions influence the localization of FGF-basic within the cell, but do not affect the biological activity of FGF-basic. Therefore, there are no detectable differences in biological activity between the full length FGF-basic 154aa and the truncated FGF-basic 147aa recombinant proteins. |
Bio-activity : | 3T3 cell proliferation, ≤5 ng/mL; ≥2.0 x 10^5 units/mg |
Molecular Mass : | Monomer, 16.5 kDa (147 aa) |
AA Sequence : | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mm sodium phosphate, 75 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens (human) ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
◆ Recombinant Proteins | ||
FGF2-678H | Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146) | +Inquiry |
FGF2-15H | Active Recombinant Human FGF2 Protein, Pre-aliquoted | +Inquiry |
Fgf2-6841R | Recombinant Rat Fgf2 Protein (Ala11-Ser154) | +Inquiry |
Fgf2-7206M | Active Recombinant Mouse Fgf2 Protein | +Inquiry |
Fgf2-397F | Active Recombinant Rat Fgf2 Protein (146 aa) | +Inquiry |
◆ Native Proteins | ||
FGF2-26551TH | Native Human FGF2 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
0
Inquiry Basket