Active Recombinant Human FGF-8a Protein (183 aa)

• Cat.No.: FGF-8a-410F
• Product Overview: Recombinant human Fibroblast Growth Factor 8a (rhFGF-8a) produced inE. coli is a single non-glycosylated polypeptide chain containing 183 amino acids. A fully biologically active molecule, rhFGF-8a has a molecular mass of 21.3 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: 183
• Description: Fibroblast Growth Factor 8a (FGF-8a) is a cytokine belonging to the heparin-binding FGF family, which has at least 23 members. FGF-8 has 8 different isoforms, named FGF-8a through FGF-8h. Different FGF-8 isoforms have different affinities to the receptors, and thus participate in different signaling cascade pathways. FGF-8 has very widespread expression during embryonic development, and is an organizer and inducer for gastrulation, somitogenesis, morphogenesis, and limb induction. However, FGF-8 is also a potential oncogene: in normal adult cells, FGF-8 has very low expression, but FGF-8 is highly expressed in cancer cells of breast, prostate, and ovarian tumors. FGF-8 promotes tumor angiogenesis by increasing neovascularization, and induces osteoblastic differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 500 ng/mL, measured by a cell proliferation assay using 3T3 cells in the presence of 1 μg/mL of heparin, corresponding to a specific activity of > 2 × 10^3 units/mg.
• Molecular Mass: 21.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Fibroblast Growth Factor 8a (rhFGF-8a) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-8a remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Official Symbol: FGF-8a
• Synonyms: Fibroblast Growth Factor 8a; FGF-8a