Active Recombinant Human FCER1A Protein (26-205aa), C-His tagged
Cat.No. : | FCER1A-25H |
Product Overview : | Recombinant human Fc epsilon RI alpha/FCER1A (26-205 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-205 aa |
Description : | The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human IgE. The ED50 range ≤ 0.01 μg/mL. |
Molecular Mass : | 21.8 kDa (186aa) |
AA Sequence : | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; FCE1A; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide; FcERI |
Gene ID | 2205 |
mRNA Refseq | NM_001387280 |
Protein Refseq | NP_001374209 |
MIM | 147140 |
UniProt ID | P12319 |
◆ Cell & Tissue Lysates | ||
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
0
Inquiry Basket