Active Recombinant Human Erythropoietin
Cat.No. : | EPO-163H |
Product Overview : | Recombinant Human erythropoietin encoding the human EPO protein sequence (containing the signal peptide sequence, and the mature Epo sequence) was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Erythropoietin (EPO) is a hormone produced primarily by the kidney and is the main regulator of red blood cell production. Its major functions are to promote the differentiation and development of red blood cells and to initiate the production of hemoglobin. EPO acts by binding to a specific erythropoietin receptor (EPOR) present on target cells, the red cell precursors in the bone marrow, stimulating them to transform into mature erythrocytes. |
Amino Acid Sequence : | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQEEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR. |
Molecular Mass : | EPO migrates as a broad band between 25 and 40 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified EPO that has a predicted molecular mass of 18.4 kDa. |
pI : | The EPO separates into a number of isoforms in 2D PAGE due to the presence of post-translational modifications, in particular glycosylation. |
% Carbohydrate : | Purified EPO consists of 25-55% carbohydrate by weight. |
Glycosylation : | EPO has N-linked and O-linked oligosaccharides. All 3 N-linked sites are verified by peptide mass fingerprinting. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of EPO is typically 0.2 - 0.8 ng/ml as measured in a cell proliferation assay using the human growth factor-dependent TF-1 cell line. |
Gene Name | EPO erythropoietin [ Homo sapiens ] |
Synonyms | EPO; erythropoietin; EP; MVCD2; MGC138142; ENSG00000130427 |
Gene ID | 2056 |
mRNA Refseq | NM_000799 |
Protein Refseq | NP_000790 |
UniProt ID | P01588 |
Chromosome Location | 7q21 |
MIM | 133170 |
Pathway | Cytokine-cytokine receptor interaction; Hematopoietic cell lineage; Jak-STAT signaling pathway |
Function | JAK pathway signal transduction adaptor activity; erythropoietin receptor binding; hormone activity; protein binding |
◆ Recombinant Proteins | ||
EPO-200H | Active Recombinant Human EPO protein, hFc-tagged | +Inquiry |
EPO-289E | Active Recombinant Human EPO Protein (166 aa) | +Inquiry |
EPO-252H | Recombinant Human EPO, StrepII-tagged | +Inquiry |
Epo-022M | Active Recombinant Mouse Epo Protein, His-tagged | +Inquiry |
Epo-1848R | Recombinant Rat Epo Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPO-592RCL | Recombinant Rat EPO cell lysate | +Inquiry |
EPO-1450MCL | Recombinant Mouse EPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPO Products
Required fields are marked with *
My Review for All EPO Products
Required fields are marked with *
0
Inquiry Basket