Active Recombinant Human ERBB3, Fc-tagged, Biotinylated

• Cat.No.: ERBB3-621H
• Product Overview: Expressed as a 860 amino acid protein consisting of Ser20-Thr643 region of HER3 and a C-terminal Fc Fusion from human IgG1, which exists as a dimmer under non-reducing condition.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: It was reported to inhibit the biological activity of Neuregulin-1 on MCF?7 human breast cancer cells.
• Molecular Mass: Calculated molecular mass (kDa): 95.1; Estimated by SDS-PAGE under reducing condition (kDa): 98
• AA Sequence: SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEF STLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVR DRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTD CFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNG LKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTV REITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCY HHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNG EPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRP CHENCTQGCKGPELQDCLGQTLVLIGKTHLTSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 20-643 a.a.

Gene Information

• Gene Name: ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) [ Homo sapiens ]
• Official Symbol: ERBB3
• Synonyms: ERBB3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian); LCCS2, lethal congenital contracture syndrome 2; receptor tyrosine-protein kinase erbB-3; HER3; proto-oncogene-like protein c-ErbB-3; tyrosine kinase-type cell surface receptor HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; MGC88033
• Gene ID: 2065
• mRNA Refseq: NM_001005915
• Protein Refseq: NP_001005915
• MIM: 190151
• UniProt ID: P21860
• Chromosome Location: 12q13
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem
• Function: ATP binding; growth factor binding; growth factor binding; nucleotide binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein homodimerization activity; protein tyrosine kinase activator activity; NOT protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity