Active Recombinant Human DPP4, His tagged

• Cat.No.: DPP4-8313H
• Product Overview: DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromatography techniques.

Specification

• Description: The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
• Source: High-5 cells
• Species: Human
• Tag: His
• Form: DPP4 is formulated in 20 mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol.
• Bio-activity: >20 Units/mg.
• AA Sequence: ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISP DGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYR ITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA GAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESS GRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEA LTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHS SVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVF RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGY VTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADD NVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH.
• Purity: Greater than 95.0% as determined by Analysis by SDS-PAGE.On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated DPP4 will migrate at approximately 90kDa.
• Applications: Unit Definition One unit will hydrolyze mmole of p-nitroaniline per minute at pH8.0 at 37℃ using 1mM of Gly-Pro p-nitroanilde as substrate.
• Notes: For research use only.
• Storage: DPP4 although stable 4 ℃ for weeks, should be stored desiccated below -18 ℃. For long term storage it is recommended to add carrier protein (0. 1% HSA or BSA). Please prevent freeze/thaw cycles.
• Protein length: 39-766 a.a.

Gene Information

• Gene Name: DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ]
• Official Symbol: DPP4
• Synonyms: DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103
• Gene ID: 1803
• mRNA Refseq: NM_001935
• Protein Refseq: NP_001926
• MIM: 102720
• UniProt ID: P27487
• Chromosome Location: 2q23-qter
• Pathway: Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem
• Function: aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity