Active Recombinant Human DPP4, His tagged

Cat.No. : DPP4-8313H
Product Overview : DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hi-5 Insect Cells
Tag : His
Protein Length : 39-766 a.a.
Description : The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Form : DPP4 is formulated in 20 mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol.
Bio-activity : >20 Units/mg.
AA Sequence : ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISP DGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYR ITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA GAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESS GRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEA LTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHS SVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVF RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGY VTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADD NVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH.
Purity : Greater than 95.0% as determined by Analysis by SDS-PAGE.On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated DPP4 will migrate at approximately 90kDa.
Applications : Unit Definition One unit will hydrolyze mmole of p-nitroaniline per minute at pH8.0 at 37℃ using 1mM of Gly-Pro p-nitroanilde as substrate.
Notes : For research use only.
Storage : DPP4 although stable 4 ℃ for weeks, should be stored desiccated below -18 ℃. For long term storage it is recommended to add carrier protein (0. 1% HSA or BSA). Please prevent freeze/thaw cycles.
Gene Name DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ]
Official Symbol DPP4
Synonyms DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103;
Gene ID 1803
mRNA Refseq NM_001935
Protein Refseq NP_001926
MIM 102720
UniProt ID P27487
Chromosome Location 2q23-qter
Pathway Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem;
Function aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPP4 Products

Required fields are marked with *

My Review for All DPP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon