Active Recombinant Human CXCL8 Protein

• Cat.No.: CXCL8-231C
• Product Overview: Recombinant Human CXCL8 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 6 ng/mL, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.
• Molecular Mass: ~9 kDa, observed by reducing SDS-PAGE
• AA Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ]
• Official Symbol: CXCL8
• Synonyms: CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
• Gene ID: 3576
• mRNA Refseq: NM_000584
• Protein Refseq: NP_000575
• MIM: 146930
• UniProt ID: P10145