Active Recombinant Human CXCL5 Protein (9-78, 70 aa)
Cat.No. : | CXCL5-424C |
Product Overview : | Recombinant human ENA-78/CXCL5 (9-78a.a.) produced in E. coli is a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhENA-78/CXCL5 (9-78a.a.) has a molecular mass of 7.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 70 |
Description : | Epithelial cellderived neutrophilactivating peptide (ENA78) also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of CXCL5 has also been observed in eosinophils, and can be inhibited with the type II interferon, IFN-γ. This chemokine stimulates the chemotaxis of neutrophils possessing angiogenic properties Full length CXCL5 (78 a.a.) is cleaved at the Nterminal end by cathepsin G and chymotrypsin to ENA-74 (74 a.a.) and ENA-70 (70a.a.), with the shortened forms showing increased potency relative to full length CXCL5. CXCL5can signal through the CXCR2 receptor. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human ENA78/CXCL5 (9-78 a.a.) on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 50 ng/mL. |
Molecular Mass : | 7.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human ENA78/CXCL5 (9-78a.a.) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human ENA78/CXCL5(9-78) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CXCL5 |
Synonyms | CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78; |
Gene ID | 6374 |
mRNA Refseq | NM_002994 |
Protein Refseq | NP_002985 |
MIM | 600324 |
UniProt ID | P42830 |
◆ Recombinant Proteins | ||
CXCL5-16H | Recombinant Human CXCL5 Protein, Biotin-tagged | +Inquiry |
CXCL5-3380M | Recombinant Mouse CXCL5 protein, His-tagged | +Inquiry |
CXCL5-692H | Recombinant Human CXCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL5-2298HF | Recombinant Full Length Human CXCL5 Protein, GST-tagged | +Inquiry |
Cxcl5-445R | Active Recombinant Rat Chemokine (C-X-C motif) Ligand 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *
0
Inquiry Basket