Active Recombinant Human CXCL13 Protein

Cat.No. : CXCL13-132H
Product Overview : Recombinant Human CXCL13 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 87 AA
Description : B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined by its ability to chemoattract human B cells using a concentration range of 1-10 ng/mL corresponding to a Specific Activity of 100,000-1,000,000 IU/mg.
Molecular Mass : 10.3 kDa
AA Sequence : VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP.
Purity : Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Notes : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Storage : Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution BCA1 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Concentration : 0.5 mg/mL
Storage Buffer : 20mM PBS & 150mM NaCl pH7.4.
Shipping : Room temperature.
Gene Name CXCL13 C-X-C motif chemokine ligand 13 [ Homo sapiens (human) ]
Official Symbol CXCL13
Synonyms CXCL13; C-X-C motif chemokine ligand 13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13
Gene ID 10563
mRNA Refseq NM_006419
Protein Refseq NP_006410
MIM 605149
UniProt ID O43927

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL13 Products

Required fields are marked with *

My Review for All CXCL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon