Active Recombinant Human CSF3 Protein
Cat.No. : | CSF3-49H |
Product Overview : | Recombinant Human CSF3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Granulocyte-colony stimulating factor (G-CSF) is a cytokine that functions as a potent inducer of neutrophilic granulocyte proliferation, terminal differentiation, and activation. G-CSF synthesis occurs in monocyte, macrophage, epithelial, endothelial, and fibroblast cells after activation by bacterial endotoxins, tumor necrosis factor alpha (TNF-α), interleukin 1 (IL-1), or interleukin 17 (IL-17). The functional activity of G-CSF is mediated through the granulocyte colony-stimulating factor receptor (G-CSF-R) to activate JAK/STAT and MAPK signal transduction pathways. G-CSF also promotes neurogenesis and inhibits neuronal apoptosis. Human and mouse G-CSF proteins are cross-reactive. |
Bio-activity : | NFS-60 cell proliferation, ≤60 pg/mL |
Molecular Mass : | Monomer, 18.8 kDa (175 aa) |
AA Sequence : | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 20 mM acetic acid, 50 mM sodium chloride. |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens (human) ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
UniProt ID | P09919 |
◆ Recombinant Proteins | ||
Csf3-280C | Active Recombinant Mouse Csf3 Protein | +Inquiry |
CSF3-1165M | Recombinant Mouse CSF3 protein(Met1-Ala208) | +Inquiry |
CSF3-26467TH | Recombinant Human CSF3 | +Inquiry |
Csf3-5616M | Active Recombinant Mouse Colony Stimulating Factor 3 (granulocyte), His-tagged | +Inquiry |
CSF3-470H | Active Recombinant Human Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket