Active Recombinant Human COL18A1 Protein (184 aa)

• Cat.No.: COL18A1-159C
• Product Overview: Recombinant Endostatin expressed in yeast, whichcauses G1 arrest of endothelial cells. Endostatin treatment results in apoptosis of HUVE and HMVE cells. Recombinant human Endostatin is a 20.2 kDa protein consisting of 184 amino acid residues.

Specification

• Species: Human
• Source: Yeast
• Protein Length: 184
• Description: Endostatin is a cleaved product of the carboxyl-terminal domain of collagen XVIII. It functions as an anti-angiogenic cytokine that is expressed in various organs especially with high levels in liver, lung, and kidney. Endostatin inhibits angiogenesis by blocking the pro-angiogenic activities of VEGF and FGF-basic.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Determined by Endothelial Cell Tube Formation. The cells treated with 10 μg/mL Endostatin showed significant anti-angiogenesis effect.
• Molecular Mass: ~20.2 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
• Endotoxin: Endotoxin level is less than 0.1 ng/μg (1 EU/μg) of Endostatin.
• Purity: Greater than 97% by SDS-PAGE
• Storage: The lyophilized Endostatin is stable for a few weeks at room temperature, but best stored at -20 centigrade. For the first use, reconstitute in water, aliquot and store at -20 centigrade to avoid multiple freeze-thaws.
• Storage Buffer: The sterile filtered solution was lyophilized with 17 mM citric-phosphate buffer, pH 6.2.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ]
• Official Symbol: COL18A1
• Synonyms: COL18A1; collagen, type XVIII, alpha 1; KNO, Knobloch syndrome, type 1; collagen alpha-1(XVIII) chain; endostatin; KNO1; KS; antiangiogenic agent; multi-functional protein MFP; KNO; FLJ27325; FLJ34914; MGC74745
• Gene ID: 80781
• mRNA Refseq: NM_030582
• Protein Refseq: NP_085059
• MIM: 120328
• UniProt ID: P39060