Active Recombinant Human CHST3 Protein, His-tagged

• Cat.No.: CHST3-01H
• Product Overview: Recombinant human CHST3 protein (39-479aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Description: This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis.
• Source: Insect cells
• Species: Human
• Tag: His
• Form: Liquid
• Bio-activity: Specific activity is > 1,000 pmol/min/μg, and is defined as the amount of enzyme that sulfate from PAPS to Chondroitin Sulfate per minute at pH 7.5, at 25 centigrade.
• Molecular Mass: 51.3kDa
• Protein length: 450aa
• AA Sequence: EKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS - PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL
• Storage Buffer: In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: CHST3 carbohydrate sulfotransferase 3 [ Homo sapiens (human) ]
• Official Symbol: CHST3
• Synonyms: CHST3; carbohydrate sulfotransferase 3; carbohydrate sulfotransferase 3; C6ST-1; GST-0; carbohydrate (chondroitin 6) sulfotransferase 3; chondroitin 6 sulfotransferase 1; chondroitin 6-O-sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; EC 2.8.2.17
• Gene ID: 9469
• mRNA Refseq: NM_004273.5
• Protein Refseq: NP_004264
• MIM: 603799
• UniProt ID: Q7LGC8