Active Recombinant Human CD86, Fc-tagged, Biotinylated

• Cat.No.: CD86-584H
• Product Overview: The recombinant human CD86-Fc fusion protein is expressed as a 452 amino acid protein consisting of Ala24 - Pro247 region of CD86 (UniProt accession #P42081) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 24-247 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds human CD28 and induces IL-2 secretion by Jurkat human acute T cell leukemia cells
• Molecular Mass: Calculated molecular mass 51.1 kDa; estimated by SDS-PAGE under reducing condition ~80 kDa probably due to glycosylation
• AA Sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRL HNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSV LLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDH IPSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CD86 CD86 molecule [ Homo sapiens ]
• Official Symbol: CD86
• Synonyms: CD86; CD86 molecule; CD28LG2, CD86 antigen (CD28 antigen ligand 2, B7 2 antigen); T-lymphocyte activation antigen CD86; B lymphocyte antigen B7 2; B7 2; B7.2; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); B70; B7-2; LAB72; CD28LG2; MGC34413
• Gene ID: 942
• mRNA Refseq: NM_001206924
• Protein Refseq: NP_001193853
• MIM: 601020
• UniProt ID: P42081
• Chromosome Location: 3q21
• Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem
• Function: coreceptor activity; protein binding; receptor activity