Active Recombinant Human CD80, His-tagged, Biotinylated

• Cat.No.: CD80-581H
• Product Overview: The recombinant human CD80 ECD protein is expressed as a 220 amino acid protein consisting of Val35 - Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 35-242 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds human CD28, CTLA4 and PD-L1. Induces IL-2 secretion in human T cells.
• Molecular Mass: Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation.
• AA Sequence: VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CD80 CD80 molecule [ Homo sapiens ]
• Official Symbol: CD80
• Synonyms: CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1; activation B7-1 antigen; costimulatory factor CD80; CTLA-4 counter-receptor B7.1; B-lymphocyte activation antigen B7; costimulatory molecule variant IgV-CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); B7; BB1; B7-1; LAB7; CD28LG; CD28LG1
• Gene ID: 941
• mRNA Refseq: NM_005191
• Protein Refseq: NP_005182
• MIM: 112203
• UniProt ID: P33681
• Chromosome Location: 3q13.3-q21
• Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem
• Function: coreceptor activity; protein binding; receptor activity