Active Recombinant Human CD40 protein, hFc-tagged

• Cat.No.: CD40-837H
• Product Overview: Recombinant Human CD40 protein(P25942)(21-193aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 21-193aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: 1. Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L, the EC50 is 3.112-3.858 ng/ml. 2. Human CD40 protein hFc tag captured on COOH chip can bind Human CD40L protein hFc and Flag tag with an affinity constant of 2.06 nM as detected by LSPR Assay.
• Molecular Mass: 48 kDa
• AA Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 92% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CD40 CD40 molecule, TNF receptor superfamily member 5 [ Homo sapiens ]
• Official Symbol: CD40
• Synonyms: CD40; CD40 molecule, TNF receptor superfamily member 5; TNFRSF5, tumor necrosis factor receptor superfamily, member 5; tumor necrosis factor receptor superfamily member 5; Bp50; p50; CD40L receptor; CD40 type II isoform; B cell-associated molecule; B cell surface antigen CD40; B-cell surface antigen CD40; CD40 antigen (TNF receptor superfamily member 5); tumor necrosis factor receptor superfamily, member 5; nerve growth factor receptor-related B-lymphocyte activation molecule; CDW40; TNFRSF5; MGC9013
• Gene ID: 958
• mRNA Refseq: NM_001250
• Protein Refseq: NP_001241
• MIM: 109535
• UniProt ID: P25942