Active Recombinant Human CD22 Protein, Fc-tagged, FITC conjugated
Cat.No. : | CD22-561HF |
Product Overview : | The FITC conjugated recombinant human CD22-Fc fusion protein is expressed as an 892 amino acid protein consisting of Asp20-Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
Availability | March 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 20-683 a.a. |
Bio-activity : | Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity. |
Molecular Mass : | Calculated molecular mass: 100.2 kDa Estimated by SDS-PAGE under reducing condition: 120-130 kDa |
AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK |
Endotoxin : | < 0.1 EU/ μg of purified recombinant protein determined by the LAL method |
Purity : | > 90 % by SDS-PAGE under reducing condition |
Characteristic : | Disulfide-linked homodimer Labeled with FITC via amines Excitation source: 488 nm spectral line, argon-ion laser Excitation Wavelength: 488 nm Emission Wavelength: 535 nm |
Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier & preservative free). |
Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
Official Symbol | CD22 |
Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
Gene ID | 933 |
mRNA Refseq | NM_001185099 |
Protein Refseq | NP_001172028 |
MIM | 107266 |
UniProt ID | P20273 |
◆ Recombinant Proteins | ||
CD22-8854CA | Recombinant Rhesus CD22 protein, Fc-tagged, APC labeled | +Inquiry |
CD22-333H | Active Recombinant Human CD22 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
CD22-441H | Recombinant Human CD22 Protein, His-tagged | +Inquiry |
CD22-3947HB | Recombinant Human CD22 protein, His-tagged, Biotinylated | +Inquiry |
Cd22-1154R | Recombinant Rat Cd22 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
0
Inquiry Basket