Active Recombinant Human CCL5 Protein (68 aa)
Cat.No. : | CCL5-059C |
Product Overview : | Recombinant Human CCL5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 68 |
Description : | CCL5 or RANTES (acronym for Regulated upon Activation, Normal T cell Expressed and presumably Secreted), was initially discovered by subtractive hybridization as a transcript expressed in T cells but not B cells. Eosinophilchemotactic activities released by thrombinstimulated human platelets have also been purified and found to be identical to RANTES. Besides T cells and platelets, RANTES has been reported to be produced by renal tubular epithelium, synovial fibroblasts and selected tumor cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to chemoattract human CCR5 transfected BaF3 mouse pro-B cells.The ED50 for this effect is typically 1-5 ng/mL, corresponding to a Specific Activity of >2 × 10^5 IU/mg. |
Molecular Mass : | 7.8 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Endotoxin : | Less than 1 EU/mg of rHuRANTES/CCL5 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CCL5 |
Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E; |
Gene ID | 6352 |
mRNA Refseq | NM_002985 |
Protein Refseq | NP_002976 |
MIM | 187011 |
UniProt ID | P13501 |
◆ Recombinant Proteins | ||
CCL5-024H | Recombinant Human CCL5 Protein | +Inquiry |
CCL5-521H | Recombinant Human CCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL5-2625H | Recombinant Human CCL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL5-4354S | Recombinant Swine CCL5 Protein | +Inquiry |
ACTRT1-9352H | Recombinant Human ACTRT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *
0
Inquiry Basket