Active Recombinant Human CCL4 Protein (69 aa)

• Cat.No.: CCL4-329C
• Product Overview: Recombinant MIP-1 beta/CCL4 produced in E. coli is a single non-glycosylated polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 69
• Description: Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4(CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemoattractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1βis a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1βhas been shown to interact with CCL3. It can signal through the CCR5 receptor.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of human MIP-1 beta/CCL4 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 100 ng/mL.
• Molecular Mass: 7.6 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human MIP-1 beta/CCL4 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human MIP-1 beta/CCL4 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens ]
• Official Symbol: CCL4
• Synonyms: CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026
• Gene ID: 6351
• mRNA Refseq: NM_002984
• Protein Refseq: NP_002975
• MIM: 182284
• UniProt ID: P13236