Active Recombinant Human CCL20 Protein (70 aa)

Cat.No. : CCL20-073C
Product Overview : Recombinant Human CCL20 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70
Description : MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/mL, corresponding to a Specific Activity of >2 × 10^4 IU/mg.
Molecular Mass : 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
AA Sequence : ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Endotoxin : Less than 1 EU/mg of rHuMIP-3a/CCL20 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ]
Official Symbol CCL20
Synonyms CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20;
Gene ID 6364
mRNA Refseq NM_001130046
Protein Refseq NP_001123518
MIM 601960
UniProt ID P78556

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL20 Products

Required fields are marked with *

My Review for All CCL20 Products

Required fields are marked with *

0
cart-icon