Active Recombinant Human CCL20 Protein (70 aa)

• Cat.No.: CCL20-073C
• Product Overview: Recombinant Human CCL20 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 70
• Description: MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/mL, corresponding to a Specific Activity of ＞2 × 10^4 IU/mg.
• Molecular Mass: 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
• AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
• Endotoxin: Less than 1 EU/mg of rHuMIP-3a/CCL20 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ]
• Official Symbol: CCL20
• Synonyms: CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20
• Gene ID: 6364
• mRNA Refseq: NM_001130046
• Protein Refseq: NP_001123518
• MIM: 601960
• UniProt ID: P78556