Active Recombinant Human CCL1 Protein (74 aa)
Cat.No. : | CCL1-111C |
Product Overview : | Recombinant Human CCL1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 74 |
Description : | Human CCL1 was initially identified by subtractive hybridization as a transcript that was present in a γ/δ T cell line but not in EBV-transformed B cells. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. Human CCL1 and mouse TCA3 also share significant sequence homology in the 5’ flanking region of their genes. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract total human T cell population using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Endotoxin : | Less than 1 EU/mg of rHuI-309/CCL1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | CCL1 |
Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-605H | Recombinant Human CCL1 protein | +Inquiry |
Ccl1-640R | Recombinant Rat Ccl1 Protein, His-tagged | +Inquiry |
CCL1-69H | Recombinant Human CCL1 Protein | +Inquiry |
CCL1-168H | Recombinant Human CCL1, His-tagged | +Inquiry |
CCL1-77H | Recombinant Human CCL1 Protein, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *
0
Inquiry Basket