Active Recombinant Human CCL1 Protein (73 aa)

• Cat.No.: CCL1-266C
• Product Overview: Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.
• Source: CHO
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of human I-309/CCL1 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR8 cells (human Gα15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/mL.
• Molecular Mass: 15 kDa, observed by reducing SDS-PAGE.
• Protein length: 73
• AA Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human I-309/CCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human I-309/CCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ]
• Official Symbol: CCL1
• Synonyms: CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1
• Gene ID: 6346
• mRNA Refseq: NM_002981
• Protein Refseq: NP_002972
• MIM: 182281
• UniProt ID: P22362