Active Recombinant Human CADM2, Fc-tagged, Biotinylated

• Cat.No.: CADM2-648H
• Product Overview: The recombinant human NECL3-Fc fusion protein is expressed as a 572-amino acid protein consisting of Gln25 - His367 region of NECL3 (UniProt accession #Q8N3J6) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 25-367 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons
• Molecular Mass: Calculated molecular mass (kDa): 63.2; Estimated by SDS-PAGE under reducing condition (kDa): 80-65
• AA Sequence: QFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSD EGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL KEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLIL TCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTL LPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CADM2 cell adhesion molecule 2 [ Homo sapiens ]
• Official Symbol: CADM2
• Synonyms: CADM2; cell adhesion molecule 2; IGSF4D, immunoglobulin superfamily, member 4D; Necl 3; NECL3; nectin like 3; SynCAM2; nectin-like 3; nectin-like protein 3; immunoglobulin superfamily member 4D; immunoglobulin superfamily, member 4D; IGSF4D; Necl-3; synCAM2; MGC104534; MGC138341; MGC138343
• Gene ID: 253559
• mRNA Refseq: NM_001167674
• Protein Refseq: NP_001161146
• MIM: 609938
• UniProt ID: Q8N3J6
• Chromosome Location: 3p12.2
• Pathway: Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem