Active Recombinant Human BMPR1B, Fc-tagged, Biotinylated

• Cat.No.: BMPR1B-555H
• Product Overview: The recombinant human BMPR1B-Fc fusion protein is expressed as a 342 amino acid protein consisting of Lys14 - Arg126 region of BMPR1B (UniProt accession #O00238) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 14-126 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Recombinant BMPR1B protein binds human BMP4 and blocks BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells)
• Molecular Mass: Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~45
• AA Sequence: KKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIP HQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ]
• Official Symbol: BMPR1B
• Synonyms: BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6
• Gene ID: 658
• mRNA Refseq: NM_001203
• Protein Refseq: NP_001194
• MIM: 603248
• UniProt ID: O00238
• Chromosome Location: 4q23-q24
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Ovarian Infertility Genes, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: ATP binding; SMAD binding; activin receptor activity, type II; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; transmembrane receptor protein serine/threonine kinase activity; transmembrane receptor protein serine/threonine kinase activity