Active Recombinant Human BMPR1B, Fc-tagged, Biotinylated
Cat.No. : | BMPR1B-555H |
Product Overview : | The recombinant human BMPR1B-Fc fusion protein is expressed as a 342 amino acid protein consisting of Lys14 - Arg126 region of BMPR1B (UniProt accession #O00238) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 14-126 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Recombinant BMPR1B protein binds human BMP4 and blocks BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells) |
Molecular Mass : | Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~45 |
AA Sequence : | KKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIP HQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | BMPR1B bone morphogenetic protein receptor, type IB [ Homo sapiens ] |
Official Symbol | BMPR1B |
Synonyms | BMPR1B; bone morphogenetic protein receptor, type IB; bone morphogenetic protein receptor type-1B; ALK6; CDw293; BMPR-1B; BMP type-1B receptor; activin receptor-like kinase 6; serine/threonine receptor kinase; ALK-6; |
Gene ID | 658 |
mRNA Refseq | NM_001203 |
Protein Refseq | NP_001194 |
MIM | 603248 |
UniProt ID | O00238 |
Chromosome Location | 4q23-q24 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Ovarian Infertility Genes, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; SMAD binding; activin receptor activity, type II; metal ion binding; nucleotide binding; protein binding; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; transmembrane receptor protein serine/threonine kinase activity; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
BMPR1B-320H | Recombinant Human BMPR1B protein, GST-tagged | +Inquiry |
BMPR1B-889H | Active Recombinant Human BMPR1B Protein, Fc Chimera | +Inquiry |
BMPR1B-5115H | Recombinant Human BMPR1B Protein (Met1-Arg126), C-His tagged | +Inquiry |
BMPR1B-84H | Recombinant Human BMPR1B, His-tagged | +Inquiry |
BMPR1B-3750HF | Recombinant Full Length Human BMPR1B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
BMPR1B-464HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMPR1B Products
Required fields are marked with *
My Review for All BMPR1B Products
Required fields are marked with *
0
Inquiry Basket