Active Recombinant Human BMPR1A, Fc-tagged

• Cat.No.: BMPR1A-554H
• Product Overview: The recombinant human BMPR1A-Fc fusion protein is expressed as a 354 amino acid protein consisting of Gln24 - Ser150 region of BMPR1A (UniProt accession #P36894) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 24-150 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Recombinant BMPR1A protein binds human BMP2 and BMP4, and blocks BMP2/BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells).
• Molecular Mass: Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
• AA Sequence: QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLA SGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ]
• Official Symbol: BMPR1A
• Synonyms: BMPR1A; bone morphogenetic protein receptor, type IA; ACVRLK3; bone morphogenetic protein receptor type-1A; ALK3; CD292; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5; SKR5; 10q23del
• Gene ID: 657
• mRNA Refseq: NM_004329
• Protein Refseq: NP_004320
• MIM: 601299
• UniProt ID: P36894
• Chromosome Location: 10q22.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Heart Development, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem
• Function: ATP binding; SMAD binding; activin receptor activity, type II; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity