Active Recombinant Human ANGPTL3 protein, His-tagged

Cat.No. : ANGPTL3-555H
Product Overview : Human ANGPTL3 (Q9Y5C1) partial recombinant protein with His tag expressed in CHO cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hamster
Tag : His
Description : This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015]
Form : Lyophilized
Bio-activity : Measured by its binding ability to recombinant alpha-v beta-3 integrin in a functional ELISA.
Molecular Mass : 62 kDa
AA Sequence : SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH
Endotoxin : Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
Purity : 98%
Applications : Functional Study; SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name ANGPTL3 angiopoietin-like 3 [ Homo sapiens ]
Official Symbol ANGPTL3
Synonyms ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2;
Gene ID 27329
mRNA Refseq NM_014495
Protein Refseq NP_055310
MIM 604774
UniProt ID Q9Y5C1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANGPTL3 Products

Required fields are marked with *

My Review for All ANGPTL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon