Active Recombinant Human ANGPT2 protein, His-tagged

• Cat.No.: ANGPT2-550H
• Product Overview: Human ANGPT2 (O15123) partial recombinant protein with His tag expressed in CHO cells.

Specification

• Description: The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Hamster
• Species: Human
• Tag: His
• Form: Lyophilized
• Bio-activity: Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 ug/ml.
• Molecular Mass: 60-70 kDa
• AA Sequence: DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 95%
• Applications: Functional Study; SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: ANGPT2 angiopoietin 2 [ Homo sapiens ]
• Official Symbol: ANGPT2
• Synonyms: ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2
• Gene ID: 285
• mRNA Refseq: NM_001118887
• Protein Refseq: NP_001112359
• MIM: 601922
• UniProt ID: O15123