Active Recombinant Human AMHR2, Fc-tagged, Biotinylated

• Cat.No.: AMHR2-535H
• Product Overview: The recombinant human AMHR2-Fc fusion protein is expressed as a 354 amino acid protein consisting of Pro18 - Ser144 region of AMHR2 (UniProt accession #Q16671) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 18-144 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Recombinant AMHR2 protein binds human AMH/MIS and blocks AMH/MIS-induced signaling activity
• Molecular Mass: Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
• AA Sequence: PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLH CDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGESTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: AMHR2 anti-Mullerian hormone receptor, type II [ Homo sapiens ]
• Official Symbol: AMHR2
• Synonyms: AMHR2; anti-Mullerian hormone receptor, type II; anti-Muellerian hormone type-2 receptor; MISR2; MISRII; M?llerian inhibiting substance type II receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; Mullerian inhibiting substance type II receptor; AMHR; MRII
• Gene ID: 269
• mRNA Refseq: NM_001164690
• Protein Refseq: NP_001158162
• MIM: 600956
• UniProt ID: Q16671
• Chromosome Location: 12q13
• Pathway: ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: ATP binding; hormone binding; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta receptor activity, type II