Active Recombinant Human AHSG Protein

• Cat.No.: AHSG-469H
• Product Overview: Human AHSG (P02765) partial recombinant protein expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008]
• Form: Lyophilized
• Bio-activity: Determined by its ability to inhibit Cathespin V cleavage of a fluorogenic peptide substrate Z-LR-AMC (RLUs). The expected IC50 is ≤ 100nM.
• Molecular Mass: 45-55 kDa
• AA Sequence: A-Chain:APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLB-Chain:TVVQPSVGAAAGPVVPPCPGRIRHFKV
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 98%
• Applications: Functional Study
  SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20centigrade.Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: AHSG alpha-2-HS-glycoprotein [ Homo sapiens ]
• Official Symbol: AHSG
• Synonyms: AHSG; alpha-2-HS-glycoprotein; A2HS; FETUA; HSGA; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein; AHS
• Gene ID: 197
• mRNA Refseq: NM_001622
• Protein Refseq: NP_001613
• MIM: 138680
• UniProt ID: P02765