Active Recombinant Human ADAMTS1 Protein, His-tagged
Cat.No. : | ADAMTS1-295H |
Product Overview : | Human ADAMTS1 (253 a.a. - 617 a.a.) amino acids 618-968 deleted partial recombinant protein with His tag expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 253-617 a.a. |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Bio-activity : | >= 1.4 mU/mg |
Molecular Mass : | 41 kDa |
AA Sequence : | FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDN |
Purity : | > 90% by SDS-PAGE |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.2 mg/mL |
Storage Buffer : | In 50 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 7.5 (0.05 % Brij-35 detergent) |
Gene Name | ADAMTS1 ADAM metallopeptidase with thrombospondin type 1 motif, 1 [ Homo sapiens ] |
Official Symbol | ADAMTS1 |
Synonyms | ADAMTS1; ADAM metallopeptidase with thrombospondin type 1 motif, 1; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; A disintegrin and metalloproteinase with thrombospondin motifs 1; C3 C5; KIAA1346; METH1; METH-1; ADAM-TS1; ADAMTS-1; ADAM-TS 1; human metalloproteinase with thrombospondin type 1 motifs; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 1; C3-C5; |
Gene ID | 9510 |
mRNA Refseq | NM_006988 |
Protein Refseq | NP_008919 |
MIM | 605174 |
UniProt ID | Q9UHI8 |
◆ Recombinant Proteins | ||
Adamts1-441M | Active Recombinant Mouse A Disintegrin-Like And Metallopeptidase (reprolysin type) With Thrombospondin Type 1 Motif, 1, His-tagged | +Inquiry |
ADAMTS1-2423H | Recombinant Human ADAMTS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS1-234R | Recombinant Rhesus monkey ADAMTS1 Protein, His-tagged | +Inquiry |
ADAMTS1-532H | Active Recombinant Human ADAMTS1, His-tagged | +Inquiry |
ADAMTS1-321M | Recombinant Mouse ADAMTS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS1 Products
Required fields are marked with *
My Review for All ADAMTS1 Products
Required fields are marked with *
0
Inquiry Basket