Active Recombinant Full Length Human TSSK2 Protein, C-Flag-tagged
Cat.No. : | TSSK2-784HFL |
Product Overview : | Recombinant Full Length Human TSSK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | TSSK2 activity verified in a biochemical assay: TSSK2 (testis-specific serine kinase 2) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK2 is a serine/threonine kinase that is highly expressed in testis and may be involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. Varying concentrations of TSSK2 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG AEVGKASTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | TSSK2 testis specific serine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | TSSK2 |
Synonyms | TSK2; DGS-G; SPOGA2; STK22B |
Gene ID | 23617 |
mRNA Refseq | NM_053006.5 |
Protein Refseq | NP_443732.3 |
MIM | 610710 |
UniProt ID | Q96PF2 |
◆ Recombinant Proteins | ||
TSSK2-2269H | Recombinant Human TSSK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tssk2-6699M | Recombinant Mouse Tssk2 Protein, Myc/DDK-tagged | +Inquiry |
TSSK2-17530M | Recombinant Mouse TSSK2 Protein | +Inquiry |
TSSK2-1252H | Recombinant Human TSSK2 Protein (D2-T358), GST tagged | +Inquiry |
TSSK2-719H | Recombinant Human Testis-specific Serine Kinase 2, GST-His | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSSK2-693HCL | Recombinant Human TSSK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSSK2 Products
Required fields are marked with *
My Review for All TSSK2 Products
Required fields are marked with *
0
Inquiry Basket