Active Recombinant Full Length Human SRR Protein, C-Flag-tagged

• Cat.No.: SRR-1114HFL
• Product Overview: Recombinant Full Length Human SRR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables several functions, including L-serine ammonia-lyase activity; PDZ domain binding activity; and anion binding activity. Involved in pyruvate biosynthetic process; response to lipopolysaccharide; and serine family amino acid metabolic process. Located in cytoplasm and neuronal cell body.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: SRR Facilitates D-serine Production from L-serine: In vitro assays, Purified human SRR converts L-serine to D-serine in a dose and time dependent manner. Y-axis is pmol of D-serine produced.
• Molecular Mass: 36.4 kDa
• AA Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL
  LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Glycine, serine and threonine metabolism
• Full Length: Full L.

Gene Information

• Gene Name: SRR serine racemase [ Homo sapiens (human) ]
• Official Symbol: SRR
• Synonyms: ILV1; ISO1
• Gene ID: 63826
• mRNA Refseq: NM_021947.3
• Protein Refseq: NP_068766.1
• MIM: 606477
• UniProt ID: Q9GZT4