Active Recombinant Full Length Human SRPK3 Protein, C-Flag-tagged
Cat.No. : | SRPK3-997HFL |
Product Overview : | Recombinant Full Length Human SRPK3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | SRPK3 activity verified in a biochemical assay: SRPK3 (SRSF protein kinase 3) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. SRPK3 is a serine/threonine kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. Varying concentrations of SRPK3 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL QHPWLNPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | SRPK3 SRSF protein kinase 3 [ Homo sapiens (human) ] |
Official Symbol | SRPK3 |
Synonyms | MSSK1; STK23; MSSK-1 |
Gene ID | 26576 |
mRNA Refseq | NM_014370.4 |
Protein Refseq | NP_055185.2 |
MIM | 301002 |
UniProt ID | Q9UPE1 |
◆ Recombinant Proteins | ||
SRPK3-31469TH | Recombinant Human SRPK3 | +Inquiry |
Srpk3-6132M | Recombinant Mouse Srpk3 Protein, Myc/DDK-tagged | +Inquiry |
Srpk3-1544M | Recombinant Mouse Srpk3 protein, His & T7-tagged | +Inquiry |
SRPK3-2101H | Recombinant Human SRPK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRPK3-1070H | Recombinant Human SRPK3 Protein (S2-P567), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPK3-566HCL | Recombinant Human SRPK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRPK3 Products
Required fields are marked with *
My Review for All SRPK3 Products
Required fields are marked with *
0
Inquiry Basket