Active Recombinant Full Length Human RXYLT1 Protein, C-Flag-tagged
Cat.No. : | RXYLT1-539HFL |
Product Overview : | Recombinant Full Length Human RXYLT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a type II transmembrane protein that is thought to have glycosyltransferase function. Mutations in this gene result in cobblestone lissencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 51 kDa |
AA Sequence : | MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLRKGAAPARERRGREQSTLESEEWNPWE GDEKNEQQHRFKTSLQILDKSTKGKTDLSVQIWGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRT QYSFITGPAVIPGYFSVDVNNVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEW INPFLKRNGGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTIYENS SRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGVNTECYRIYEACSYGSI PVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKELPAVLEKEKTIILQEKIERRKMLLQWYQH FKTELKMKFTNILESSFLMNNKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | RXYLT1 ribitol xylosyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | RXYLT1 |
Synonyms | TMEM5; HP10481; MDDGA10 |
Gene ID | 10329 |
mRNA Refseq | NM_014254.3 |
Protein Refseq | NP_055069.1 |
MIM | 605862 |
UniProt ID | Q9Y2B1 |
◆ Recombinant Proteins | ||
NEUROD4-6023M | Recombinant Mouse NEUROD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL5108RF | Recombinant Full Length Rat Trace Amine-Associated Receptor 7E(Taar7E) Protein, His-Tagged | +Inquiry |
CD3D & CD3E-1253H | Active Recombinant Human CD3D & CD3E Protein, Flag & His-tagged | +Inquiry |
crp-848Z | Recombinant Zebrafish crp Protein, His-tagged | +Inquiry |
nei-53E | Active Recombinant E.coli nei | +Inquiry |
◆ Native Proteins | ||
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
IgA2-211H | Native Human Immunoglobulin A2 (IgA2) | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGA1-5480HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
RPN2-2182HCL | Recombinant Human RPN2 293 Cell Lysate | +Inquiry |
PAIP1-3460HCL | Recombinant Human PAIP1 293 Cell Lysate | +Inquiry |
DERL2-6970HCL | Recombinant Human DERL2 293 Cell Lysate | +Inquiry |
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RXYLT1 Products
Required fields are marked with *
My Review for All RXYLT1 Products
Required fields are marked with *
0
Inquiry Basket