Active Recombinant Full Length Human PRMT1 Protein, C-Flag-tagged
Cat.No. : | PRMT1-309HFL |
Product Overview : | Recombinant Full Length Human PRMT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro methylation assay (enzyme) |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT IDLDFKGQLCELSCSTDYRMRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PRMT1 protein arginine methyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | PRMT1 |
Synonyms | ANM1; HCP1; IR1B4; HRMT1L2 |
Gene ID | 3276 |
mRNA Refseq | NM_001536.6 |
Protein Refseq | NP_001527.3 |
MIM | 602950 |
UniProt ID | Q99873 |
◆ Recombinant Proteins | ||
PRMT1-1770H | Recombinant Human PRMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT2-67H | Active Recombinant Human PRMT2, FLAG-tagged | +Inquiry |
PRMT1-3411H | Recombinant Human PRMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRMT1-623H | Recombinant Human PRMT1 | +Inquiry |
PRMT1-10921Z | Recombinant Zebrafish PRMT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT1-500HCL | Recombinant Human PRMT1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT1 Products
Required fields are marked with *
My Review for All PRMT1 Products
Required fields are marked with *
0
Inquiry Basket