Active Recombinant Full Length Human NIT2 Protein, C-Flag-tagged
Cat.No. : | NIT2-243HFL |
Product Overview : | Recombinant Full Length Human NIT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 30.4 kDa |
AA Sequence : | MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGESTQKLS EVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFST FDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVATASPAR DDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NIT2 nitrilase family member 2 [ Homo sapiens (human) ] |
Official Symbol | NIT2 |
Synonyms | HEL-S-8a |
Gene ID | 56954 |
mRNA Refseq | NM_020202.5 |
Protein Refseq | NP_064587.1 |
MIM | 616769 |
UniProt ID | Q9NQR4 |
◆ Recombinant Proteins | ||
NIT2-26965TH | Recombinant Human NIT2, His-tagged | +Inquiry |
NIT2-1297H | Recombinant Human NIT2, His-tagged | +Inquiry |
NIT2-1471A | Recombinant Arabidopsis thaliana NIT2 Protein (M1-K339), His-tagged | +Inquiry |
NIT2-11648Z | Recombinant Zebrafish NIT2 | +Inquiry |
NIT2-3365H | Recombinant Human Nitrilase Family, Member 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIT2-3823HCL | Recombinant Human NIT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NIT2 Products
Required fields are marked with *
My Review for All NIT2 Products
Required fields are marked with *
0
Inquiry Basket