Active Recombinant Full Length Human LRATD1 Protein, C-Flag-tagged

• Cat.No.: LRATD1-491HFL
• Product Overview: Recombinant Full Length Human LRATD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in cell morphogenesis and cell motility. Predicted to be located in cytoplasm.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Immunoprecipitation
• Molecular Mass: 32.3 kDa
• AA Sequence: MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSR HHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAP APHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWT NSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRV
  LQELADLVDDKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: LRATD1 LRAT domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: LRATD1
• Synonyms: NSE1; FAM84A; PP11517
• Gene ID: 151354
• mRNA Refseq: NM_145175.4
• Protein Refseq: NP_660158.2
• MIM: 611234
• UniProt ID: Q96KN4