Active Recombinant Full Length Human LAP3 Protein, C-Flag-tagged

Description :	Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
Source :	Mammalian cells
Species :	Human
Tag :	Flag
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity :	LAP3 activity verified in a biochemical assay: Leucine aminopeptidase 3 (LAP3, TP309052) activity was measured in a fluorescent biochemical assay. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides and is most active on leucine. LAP3 activity was measured in a 100 µl reaction mixture containing 1 mM L-leucine 7-amido-4-methyl coumarin (Leu-AMC), 50 mM Tris, pH 8.0, 4 mM MgCl2, and 1 mM MnCl2. Cleavage of leucine from the AMC moiety results in a strong increase in fluorescence intensity. Fluorescence was measured over time with an excitation wavelength of 380 nm and an emission wavelength of 460 nm. The activity of the enzyme in this system remained constant over six hours.
Molecular Mass :	56 kDa
AA Sequence :	MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD EVPYLRKGMTGRPTRTLIEFLLRFSQDNATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Druggable Genome, Protease
Protein Pathways :	Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways
Full Length :	Full L.

Gene Name	LAP3 leucine aminopeptidase 3 [ Homo sapiens (human) ]
Official Symbol	LAP3
Synonyms	LAP; PEPS; LAPEP; HEL-S-106
Gene ID	51056
mRNA Refseq	NM_015907.3
Protein Refseq	NP_056991.2
MIM	170250
UniProt ID	P28838