Active Recombinant Full Length Human GSK3A Protein, C-Flag-tagged
Cat.No. : | GSK3A-156HFL |
Product Overview : | Recombinant Full Length Human GSK3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro kinase assay (enzyme) Thermophoresis assay |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Chemokine signaling pathway |
Full Length : | Full L. |
Gene Name | GSK3A glycogen synthase kinase 3 alpha [ Homo sapiens (human) ] |
Official Symbol | GSK3A |
Synonyms | DKFZp686D0638 |
Gene ID | 2931 |
mRNA Refseq | NM_019884.3 |
Protein Refseq | NP_063937.2 |
MIM | 606784 |
UniProt ID | P49840 |
◆ Recombinant Proteins | ||
GSK3A-634H | Recombinant Human GSK3A protein, His & GST-tagged | +Inquiry |
GSK3A-0315H | Recombinant Human GSK3A Protein (S2-S483), Tag Free | +Inquiry |
GSK3A-3577H | Recombinant Human GSK3A Protein (Gln115-Leu409), N-GST tagged | +Inquiry |
GSK3A-3328HF | Recombinant Full Length Human GSK3A Protein, GST-tagged | +Inquiry |
GSK3A-1984R | Recombinant Rhesus monkey GSK3A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3A-5723HCL | Recombinant Human GSK3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSK3A Products
Required fields are marked with *
My Review for All GSK3A Products
Required fields are marked with *
0
Inquiry Basket