Active Recombinant Full Length Human GPNMB Protein, C-Flag-tagged
Cat.No. : | GPNMB-321HFL |
Product Overview : | Recombinant Full Length Human GPNMB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Pull-down assay |
Molecular Mass : | 61.5 kDa |
AA Sequence : | MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT PGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD PLLKNQEFKGVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | GPNMB glycoprotein nmb [ Homo sapiens (human) ] |
Official Symbol | GPNMB |
Synonyms | NMB; HGFIN; PLCA3 |
Gene ID | 10457 |
mRNA Refseq | NM_001005340.2 |
Protein Refseq | NP_001005340.1 |
MIM | 604368 |
UniProt ID | Q14956 |
◆ Recombinant Proteins | ||
GPNMB-747HA | Recombinant Human GPNMB protein, Fc-tagged, APC labeled | +Inquiry |
GPNMB-1265H | Recombinant Human GPNMB protein, hFc&His-tagged | +Inquiry |
GPNMB-748H | Recombinant Human GPNMB Protein, hFc-tagged | +Inquiry |
GPNMB-5162H | Recombinant Human GPNMB Protein, GST-tagged | +Inquiry |
GPNMB-11H | Recombinant Human glycoprotein (transmembrane) nmb Protein, Fc&Avi tagged, Biotin Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPNMB-1886HCL | Recombinant Human GPNMB cell lysate | +Inquiry |
GPNMB-1423MCL | Recombinant Mouse GPNMB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPNMB Products
Required fields are marked with *
My Review for All GPNMB Products
Required fields are marked with *
0
Inquiry Basket