Active Recombinant Full Length Human FOXO1 Protein, C-Flag-tagged
Cat.No. : | FOXO1-1038HFL |
Product Overview : | Recombinant Full Length Human FOXO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro kinase assay substrate |
Molecular Mass : | 69.5 kDa |
AA Sequence : | MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADF MSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPA AAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK NSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSG QEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSR VLGQNVMMGPNSVMSTYGSQVSHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKT PVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDF NFDNVLPNQSFPHSVKTTTHSWVSGLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Insulin signaling pathway, Pathways in cancer, Prostate cancer |
Full Length : | Full L. |
Gene Name | FOXO1 forkhead box O1 [ Homo sapiens (human) ] |
Official Symbol | FOXO1 |
Synonyms | FKH1; FKHR; FOXO1A |
Gene ID | 2308 |
mRNA Refseq | NM_002015.4 |
Protein Refseq | NP_002006.2 |
MIM | 136533 |
UniProt ID | Q12778 |
◆ Recombinant Proteins | ||
FOXO1-3151HFL | Recombinant Full Length Human FOXO1 protein, Flag-tagged | +Inquiry |
FOXO1-146H | Recombinant Human FOXO1 protein, MYC/DDK-tagged | +Inquiry |
FOXO1-2043R | Recombinant Rat FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXO1-6006M | Recombinant Mouse FOXO1 Protein | +Inquiry |
FOXO1-3028H | Recombinant Human FOXO1 Protein (Ser301-Gly655), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXO1 Products
Required fields are marked with *
My Review for All FOXO1 Products
Required fields are marked with *
0
Inquiry Basket