Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged

• Cat.No.: EEF1B2-460HFL
• Product Overview: Recombinant Full Length Human EEF1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Biolayer interferometry (BLI) assay
• Molecular Mass: 24.6 kDa
• AA Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
  EDYVQSMDVAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ]
• Official Symbol: EEF1B2
• Synonyms: EF1B; EEF1B; EEF1B1
• Gene ID: 1933
• mRNA Refseq: NM_001959.4
• Protein Refseq: NP_001950.1
• MIM: 600655
• UniProt ID: P24534