Active Recombinant Full Length Human deoxycytidine kinase Protein, His tagged
Cat.No. : | DCK-06HFL |
Product Overview : | Recombinant full length (aa 1-260) Human Deoxycytidine kinase (dCK) variant (R104M, D133A) purified by nickel-sepharose chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-260 aa |
Description : | Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity. |
Tag : | N-His |
Molecular Mass : | ~31 kDa |
AA Sequence : | MATPPKRSCPSFSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLS(R> M)IRAQLASLNGKLKDAEKPVLFFERSVYS(D> A)RYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
Bio-activity : | 145 IU/mg protein; kcat 1.22/sec with dC as substrate; One unit of WT human dCK converts 1.0 μmole of dC and ATP to dCMP and ADP per minute at pH 7.5 at 37 centigrade, as measured by a coupled enzyme system with 200 μM dC and 1 mM ATP. |
Purity : | > 99% (SDS-PAGE) |
Storage : | At -80 centigrade. |
Storage Buffer : | 25 mM Tris pH7.5, 500 mM NaCl, 20 % glycerol, 10 mM DTT, 1 mM EDTA |
Concentration : | 4.8 mg/mL |
Shipping : | Dry ice. |
Reference : | 1. Sabini E, Ort S, Monnerjahn C, Konrad M, Lavie A. Structure of human dCK suggests strategies to improve anticancer and antiviral therapy. Nat Struct Biol. 2003 Jul;10(7):513-9.Hazra S, Sabini E, Ort S, Konrad M, Lavie A. 2. Extending thymidine kinase activity to the catalytic repertoire of human deoxycytidine kinase. Biochemistry. 2009 Feb 17;48(6):1256-63. doi: 10.1021/bi802062w. 3. Neschadim A, Wang JC, Sato T, Fowler DH, Lavie A, Medin JA. Cell fate control gene therapy based on engineered variants of human deoxycytidine kinase. Mol Ther. 2012 May;20(5):1002-13. doi: 10.1038/mt.2011.298. Epub 2012 Jan 24. |
Gene Name | DCK deoxycytidine kinase [ Homo sapiens (human) ] |
Official Symbol | DCK |
Synonyms | DCK; deoxycytidine kinase; deoxycytidine kinase; deoxyadenosine kinase; deoxyguanosine kinase; deoxynucleoside kinase; EC 2.7.1.113; EC 2.7.1.74; EC 2.7.1.76 |
Gene ID | 1633 |
mRNA Refseq | NM_000788 |
Protein Refseq | NP_000779 |
MIM | 125450 |
UniProt ID | P27707 |
◆ Recombinant Proteins | ||
DCK-1626Z | Recombinant Zebrafish DCK | +Inquiry |
DCK-05HFL | Active Recombinant Full Length Human deoxycytidine kinase Protein, R104M, D133A, His tagged | +Inquiry |
DCK-1793R | Recombinant Rat DCK Protein | +Inquiry |
DCK-2803HF | Recombinant Full Length Human DCK Protein, GST-tagged | +Inquiry |
DCK-185H | Active Recombinant Human DCK protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCK-7051HCL | Recombinant Human DCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCK Products
Required fields are marked with *
My Review for All DCK Products
Required fields are marked with *
0
Inquiry Basket